SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000237525 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000237525
Domain Number 1 Region: 63-149
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.23e-23
Family Helical scaffold and wing domains of SecA 0.00082
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.91e-16
Family Tandem AAA-ATPase domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000237525
Sequence length 175
Sequence
MVLHKGEIAEMRTGEGKTLVAILPXYLNALIGKGVCVVTINDYLAXRDCEWVGQIPRFLR
LKSKAPGLTKDAESFLVLSNIDRLWKEHLQALKFVQQAVGLRGYARWDPLIEYKLEGYNL
FLEMMAQIRRNVIYSIYQFQPVMVKKEDDQREDKNSGKXVTNDRSNNDPDPVSAV
Download sequence
Identical sequences MDP0000237525 MDP0000237525|PACid:22622619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]