SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000239289 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000239289
Domain Number 1 Region: 71-349
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.66e-34
Family FAD-linked reductases, N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000239289
Sequence length 440
Sequence
MAATVAVDPYVLWTFFASLLGFLALSVLRRRNSDHAKSNAQKNKSNTTIVQDKSINSSDD
GEFPPIHGSGTDVIVVGAGVAGAALALTLAKEGRHVHVIERDLTEPDRIVGELLQPGGYL
KLMELGLEDCVEEIDAQRVVGYVLFKDGKNTRLTYPLEQFHSDVAGRSFHNGRFIQRMRQ
KAAKLPNSTEVRCLVDVPGQRVPPIANGAMANYLKTAVAPQVPPELHDAFVAAIDKGNIR
TMPNRSMPANPQPTPGALLLGDAFNMRHPLTGGGMTVALSDIVVLKDLLKPLRNLHDAAS
LCTYLESFYTLRKPVASTINTLAGALYKVFSTSPDEARTEMRQACFDYLSLGGACSTGPV
ALLSGLNPCPLNLVLHFFAVAVYGVGRLLLPFPSPRRVWIGARLLLSASGIIXPIIKAEG
VRQMFFPATIPAHHRAPPAE
Download sequence
Identical sequences MDP0000239289 MDP0000239289|PACid:22649630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]