SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000239909 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000239909
Domain Number 1 Region: 8-198
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 2 Region: 220-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000239909
Sequence length 412
Sequence
MQPXLASRHVAVIGAGAGGLIAARELWREGHKVVVFEREDQVGGTWVYTPKVESDPIGIH
PNRTTVHSSMYESLRTNLPREVMGFRDYPFVAREGDEERDPRRFXGHKEVLMYLKDFSRE
FGVAEMVRLETEVVVVDAAEGINTWKGKQFHSHNYRHPEPFRDQVVILIGSSASAVDISR
EIAGVAKEVHIASRSVADETLQKQPGYDNMWLHSMIENAHDDGSVVFKDGSVVLADTILH
CTGYKYHFPFLETNGTVTVDDNRVGPLYKHVLPPASAPSLSFVGIPWKVVPFPLFEFQSK
WIAGLLSNRIALPSKEEMMEDVKAFYSLLEASGTPKRYTHNLGGCQFEYDDWIAAQCGCP
VSEEWRKQMYSEVSKNKCARPETYRDEWEDDHLVLQAYEDFKKYTLNGVSNG
Download sequence
Identical sequences MDP0000239909 MDP0000239909|PACid:22648375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]