SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000241703 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000241703
Domain Number 1 Region: 139-182
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000207
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000241703
Sequence length 200
Sequence
MGCTDAQTCHPGLSIRKSLFSLVGDRIYHLGVDDGVGFLTRLFSPQCRSPLLSVYADMSV
TCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATLKELAKLFPDEIAADQSKAKILKYH
VVKTPRSVYKTVPGCEPCRPLQRSPLEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ
DYELLAARGKKTTLAEAAAR
Download sequence
Identical sequences MDP0000241703|PACid:22642424 MDP0000241703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]