SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000247171 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000247171
Domain Number 1 Region: 6-174,271-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-52
Family FAD-linked reductases, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000247171
Sequence length 405
Sequence
MARVEDVVIVGAGIAGLATAVALKRAGVEAXVLEKSDGLRATGAALTLFPNAWCALDALG
VSQHLTSLYAPIKKGYVTDIDTGEIQEVSFAASNGNDPVXPRSVNRKALLKTLADELPPN
SIRFASKLTAIETQEHEGSSISVIHMGDGTIIKAKILIGCDGIHSVVARWLGLAEPVYSG
RWAVRGLAVFPEGHRLDYNVQQYVGLNRRAGFVPLNDKEIYWFFGTSPAKGTDLGDEPEV
IRQEVIENYAKDLPPIYLDIVQHSDLSTLSWAPLMFRYPWNVVFGNLGKQNITVAGDAMH
PMTPDLGQGGCLALEDAVVLGRYIGTSFVQNGRLVPKEIDSAIGKYVEERRWRVALLTAG
SYLSGWVQHLGPGWVRKFLRDAIFYRFIFTKLVKLSHYDCGKLDF
Download sequence
Identical sequences MDP0000247171|PACid:22623108 MDP0000247171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]