SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000248995 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000248995
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-62
Family GDI-like N domain 0.0000000341
Further Details:      
 
Domain Number 2 Region: 390-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000634
Family GDI-like N domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000248995
Sequence length 444
Sequence
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDK
PPAHLGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPA
TDMEALKSPLMGLFEKRRARKFFIYVQDYNETDPKTHEGMNLTRVTTRDLIAKYGLDDNT
VDFIGHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLNKPECKVEFNEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVAR
AIAIMSHPIPNTNESHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAET
DHPETELRPGIDLLGPVDEIFFEMYDRYEPVNEPTLDNCFISTSYDATTHFESTVMDVLN
MYTLITGKVLDLSVDLSAASAAEE
Download sequence
Identical sequences MDP0000248995 XP_008394248.1.92800 MDP0000248995|PACid:22642703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]