SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000255696 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000255696
Domain Number 1 Region: 668-930
Classification Level Classification E-value
Superfamily RNI-like 6.87e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.026
Further Details:      
 
Domain Number 2 Region: 60-279
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.88e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.007
Further Details:      
 
Domain Number 3 Region: 221-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0073
Further Details:      
 
Domain Number 4 Region: 342-471
Classification Level Classification E-value
Superfamily EF-hand 0.00000000152
Family Calmodulin-like 0.015
Further Details:      
 
Weak hits

Sequence:  MDP0000255696
Domain Number - Region: 596-626
Classification Level Classification E-value
Superfamily F-box domain 0.0111
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000255696
Sequence length 1121
Sequence
MRGFAFFDRVSKAFHDYPKASKMLVVVAVSGGGYVAYAEANSEPKLISSAPGIDQGENKK
KKIXVLGTGWAGTSFLRNLKNPNYEVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRN
IVRKKNVDVQFSEAACLKIDAQNKKIYCRSNLENNLNGQEEFVVDYDYLIIAVGANVNTF
NTPGVMENCHFLKEVEDAQKIRKTVIDCFERASLPTVSDEEKKRILHFAVVGGGPTGVEF
AAELHDYVNEDLVKLYPGVKELVKITLLEAGDHILNMFDKRITAFAEEKFQRDGIDLKTG
SMVVKVTDKEIFTKELKNGGEVSAMPYGMALWSTGIGTRPFIKDFMAQVGQANRRALATD
EWLRVEGCDKVYAIGDCATINQRKVMEDIAAIFRKADKDNSGTLTIKEYQEVIKDICERY
PQVELYLKSKQMKNMVDLLKETADVSKGNAELNIEHFKTALSKVDSQMKNLPATGQVAAQ
QGVYLAKCFNRMEQCEKSPEGPLRFRGEGRHRFHPFRYKHLGQFAPLGGEQTAAQLPGDW
VSIGHSSQWLWYSVYASTLAPTFSSPLTSGFPHHFSQLRPHLDLPLPYMDSQRKKVLEQV
LNLVTSPKDRSSVSLVCKDWYDVERHSRRHVFIGNCYSVSPEIVTXRFPNIRSVTLKGRP
RFSDFNLVPPNWGGDVRPWLDVFAXEYPQLEELRLKRMTVSDESLEFLAASFADFKALSL
LSCDGFSTDGLEAIATDCKNLTELDIQENDIDDKSGDWLSCFPENFTSMEILNFSCLNSD
VDFDALESLVSRCKSLKVLKVNKTVTLDQLRSLLNHAPQLLELGTGSFWQELTPSQHSEL
ERVFSNCKNLHALSGLWQATALYLPVLYPVCTNLTFLNLSYAATLQSWDLAKLVANCPHL
RRLWVLDTVEDKGLEAVGSNCPLLEELRVFPSSPDGDDIVDGVTESGFVAVSNGCPRLRY
VLYFCWQMTNAAVATVAQNCPDITHFRLCIMTPAKPDHLTGEPMDEAFGAVVKTCXKLER
LSVSGLLTDLTFEYIGKYAKNLEYLSVAFAGDSDQGMQSLWMSACXVTMNACRSLASKVR
RLNVEVMKDDENGDDSQADKVYVYRSIAGPRKDAPAFVLTF
Download sequence
Identical sequences MDP0000255696 MDP0000255696|PACid:22677008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]