SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000257243 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000257243
Domain Number 1 Region: 111-387,558-613
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-42
Family FAD-linked reductases, N-terminal domain 0.0000062
Further Details:      
 
Domain Number 2 Region: 390-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.87e-33
Family GMC oxidoreductases 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000257243
Sequence length 616
Sequence
MPANFMDQIKVEPDKCIALRILVPTAHLYKKESESSYIKIHPLCLRSYWKQLQNQRKYFG
LRIERRNMEKSTTAAILLLLYFFGFCPQPGVPSFANPSDDLGKYSMKVSLVFQNFSYVKF
VRNATDLPLQEEYDYIVVGGGTAGCPLATTLSANYSVLLLERGNIPSAYPNVLHDGKTPA
QRFTSEDGVANLRGRILGGSSMINIGXYSRADGEFYQKSGIKLDMNLVNNSYXWVENTVA
FRPNVTHWQSVVKDAMLEAGVRPDNGLTLDHILGSKVSATLFDDRGKRHGAVEHLNKAHP
KNLRVAILATVERIIFSSKASGLSAKGIIYSDSNGRSHRALIRGKGEVILSAXAIGSXQL
LLLSGVGPKSYLSSRKIPVVHPQPYVGQFMRDNPRNYITILPPFQVEASTVQVVGITSDY
YIETFSGLPFSRQAFSLFPSPTIPMTINSSFGHIMVKFPGPLSYGSLELQSSYDVKVAPN
VKFNYFAQEADLSHCVSAVRKIGDLLKTNSLKPYKAQDLPGVEGFNLFGPPLPVNQSDDA
SFETFCRDTVATFWHYHGGCLVGKVVDEDLRVMGIKALRVVDGSVFNVLSPGTNPQATLM
MLGRYFGVQMLEERSE
Download sequence
Identical sequences MDP0000257243|PACid:22657003 MDP0000257243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]