SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000258995 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258995
Domain Number 1 Region: 503-761,880-912
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.73e-34
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 745-861
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-25
Family L-aminoacid/polyamine oxidase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000258995
Sequence length 921
Sequence
MDLMPWGMKSKVESIQASTSSMETTLTSGNKQSPAKLGPWSSIPGRTARSESYKLPQVLS
QVEISEHDTMLSLTEKNFKXREDLLGIVHEIALKQGYAIVTRRSKIPSSLRQSNPNLQAI
SQSFYNERYQIMKQSLGGHMVVQALLDELGQGGFTYNIEYDQNGHLTHLFFAHPISIALT
KSYSNVFVMDCTYKTNKYKMPLLDIIRVSSFNTFYSCFAFIQKEEEEDYVWSLTMFSKLL
GIDNHPVVIILDRELVLMKAIESVFPRTTNILCVWHIEKNILTNCKSHFENEDDWVNFIS
TLTSLIQYLDESSFNKAWNCFEVKYKDKYNNSILKYITATWLPFKEKFVSAWTEQVMHFG
NRVSSRAQGAHAMLKKEVHEQWRIDTRSFSDVCDVILDGDRDEISDLFADFKSKYKKMPI
SEKEVDAGGGHCQPITMSTARIAATQPLFFSAPHCHRPPSIYVVDSKPNRTSPSLKLRCS
VAKESTISPSGINGEGTQSVSVDCVVVGGGISGLCIAQALATKHGDTVPNVIVTEARDRV
GGNIITVEKDGYLWEEGPNSFQPSDPMLTMMVDCGLKDDLVLGDPNAPRFVLWDGKLRPV
PSSPADIPFFDLMSIGGKLRAAFGALGIRPSPPPPGREESVEEFVRRNLGDEVFERLIEP
FCSGVYAGDPSKLSMKAAFGKVWQLEQNGGSIIGGAIKAIQGRNRAPKTPRDPFSKGVFR
NQRAKQLDLLGRDLVAAADALSKFYYPPVAAVSISYPKEAIRTDCLIDGELKGFGQLHPR
SQGLKTLGTIYSSSLFPNRAPPGRVLLLNYIGGATNPGILSETESKLVEAVDQDLRKVLL
NHNAKEPLVLGVKVWPQAIPQFLVGHFDVLDAAKAGLSDTGTQGLFLGGNYVTGVALGRC
VEGAYDVAAEVANFVSKYAYK
Download sequence
Identical sequences MDP0000258995 MDP0000258995|PACid:22632347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]