SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000259265 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000259265
Domain Number 1 Region: 167-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000259265
Sequence length 428
Sequence
MRLRRRTPKFESILSDNEERKYGFAYERKIHFGAAGLGWWEFAVGSVAVVYLLLLFVSNP
GNFFTSEKIVCXTKKCNGALRKDTLRDVGLCVAQRHFAQXRVIMRVEIQMVGFYKLRLSS
PSRARAVSKMSSSSSLHGPNTAPMSASSNGNPNSSENNDIVSDHHHVSVVIVGAGPSGIA
TSALLNSHSVPNLVFEREDCCASLWKKRSYDRLNLHLAKGYCSLPLMPHSFRTSTFMSKY
DFIAYLDEYVSRFNVKPRYCRHVDSAVCDEDEEIWKVKVTGPDQYEYYSSDFLVVATGEN
NQAIIPADLPGLESFTGKVVHACDYKNGESFKDKQVLVIGCGNSGMEISNDLADNGAHAS
LVIRSQMHVLSKEMVAIGMLLLDYLPVKIVDKFVSFLANLGIRICPAMAFIARTKALFSL
KHLLERGQ
Download sequence
Identical sequences MDP0000259265|PACid:22650727 MDP0000259265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]