SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000261301 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261301
Domain Number 1 Region: 15-358
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.33e-36
Family GDI-like N domain 0.00021
Further Details:      
 
Domain Number 2 Region: 374-455
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000184
Family GDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000261301
Sequence length 505
Sequence
MSDSSLYDPIELETTTFDLIVVGTGLPATVIAAAASAAGKTVLHLDRNHFYGSQFASLHL
DQLTSFINSHATPPSTIIDTTSTSISHDYTVLDVTLRSVYSSIETANYAPEIVADQSSKF
LIDLGGPRVLFCADKAVDLIVKSGVDSYLTFKSIDVSFICDESGGLSNVPDSRSAIFKDK
SLSLIEKNQLMRFFKLVQQHLAASAGDDGGSESSKISEEDLESPFADFLKRMRLPPKIKS
IILYAISLADDDQDSLEVCKTVLKTREGMQRLDLYQKSVXRFPNVPGALLYPLYGHGEMS
QGFSRCAAVKGCIQVLRMPVTALLMDKENGQYKGVRLASGEEKLSHLLVLDPTLTVRLPP
TSSSPDLKETLQDTSIRAIQIGGGSDKLAVCPSGMFVLYFSGLCDDAEHGKRLLHAAMNX
LLTLPISANPESGSAVQSEDAEVKPTLLWSTLYIQELTMVHNGEHENIFFTPVPDGNLNY
NDLVDSTAAVHILLTDYFCFIALYA
Download sequence
Identical sequences MDP0000261301|PACid:22674262 MDP0000261301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]