SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000261625 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261625
Domain Number 1 Region: 4-348,451-490
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.67e-53
Family FAD-linked reductases, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 331-437
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-27
Family L-aminoacid/polyamine oxidase 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000261625
Sequence length 551
Sequence
MDSPSSSSVIIVGAGVSGLSAAKVLIENGVEDVVILEASDRIGGRIRKQDFGGVSVELGA
GWIVGVGGXELNPVLDLALKSNLRTIFSDYSNARYNIYDRSGKIFPRGLVEETYKKEVES
AVQKLKKLEAGGGDFSNVTEPPTTQKTPIELAIDFTLHDFEMPEVEPISTFLDYGEREFL
VADERGYEHMLYKMAEDVLFTSEGKLLDSRLKFNKMFNLNXYYRYPXSLNXXILWGGFLG
TSHVTFYGXIXIFTVIHLXEDDSKLDLGQVVRELQHSRNGVTVMTEDGCVFQANYMILSV
SIGVLQSNLIAFNPPLPRWKTEAIQKCDVIVYTKIFLKFPYKFWPCGPGQEFFLYAHERR
GYYTFWQHMENAYPGSNMLVVTLTNGESKRVEAQSDKETLNEAMAALKDMFGPDIPEATD
ILVPRWWNNRFQRGSYSNYPMISDNQFVHDIKNPVGRLFFTGEHTSEKFSGYVHGGHLAG
IETGKALLEEMEKEKERTSESENQAFLLEPLLALTGSLSLTQNDAVSSLKCDIPKRSYLS
GKVGIAELCYD
Download sequence
Identical sequences MDP0000261625|PACid:22630921 MDP0000261625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]