SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000261638 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261638
Domain Number 1 Region: 442-600
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-27
Family GDI-like N domain 0.00000637
Further Details:      
 
Domain Number 2 Region: 685-728
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000259
Family GDI-like N domain 0.0044
Further Details:      
 
Domain Number 3 Region: 619-684
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000576
Family GDI-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000261638
Sequence length 739
Sequence
MEAAEATIKQQVEYNIRLRAQLEYKILELHRYKLHESMAAQLLPSARESQDQAHQVAAAG
VDNRIEMIANHATKSMKVVRVFGTPTAADNASNGISRLSSPSTMTSLSPGRSTMEGDYGN
GLMPLTESNNPNSRMLKKDLVVRVHKHDQEIMQLRKHLADYSIKEAQTRNEKYVLEKRIA
GCVGGLRVQLLNLGFSLLKMLIKLLALCMNGHLPRAPMLLIIHFGTVFGKPTPRVELNFV
FGGFLEILPTRTNWRKKRVALENICVLCNSSRELALHVFSACPFARAVFFSSNIETGTRG
VVPSSFCNWLNQCPAALSSSQFGLLLMRCLFTLYGELILSYGTARWRTLHSCVILQAFIS
LILLKLSQPSNLATSVSFSLTSSPTVMDQDYVDVLSMLLQILGVLPHLIFLAYLLPINQI
PISLTQTQKNAEWVSLSSLKAMDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYY
GGESTSLNLNQFMMANGGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKKRRARKFFIYVQD
YDENDPKSHEGMDLNKVTARELILKYGLDDNTVDFIGHALALHRDDNYLAEPAMAFVKRM
KCSIICSTSSRKVICRVASTLSRRISIYLSPVWSRRAPPAPKGKYIAFVLTEAETDNPQV
ELKPGTDLLGAVDEIFFDTYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSKI
TGKALDLSVDLSAASAAEE
Download sequence
Identical sequences MDP0000261638|PACid:22646820 MDP0000261638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]