SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000261821 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261821
Domain Number 1 Region: 2-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.39e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0019
Further Details:      
 
Domain Number 2 Region: 339-432
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000000000000302
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000261821
Sequence length 434
Sequence
MAAKNFKYVILGGGVSAGYAAREFAKQGLKPGELAVISKEAVAPYERPALSKAYLXPESP
ARLPGFHVCVGSGGERLLPDWYKEKGIELILSTEIVKADLPGKTLVSGTGESFKYETLVI
ATGSTVIRLSDFGVKGADAKNIFYLREIDDADKLNEAIKAKKNGKAVIVGGGYIGLELGA
XLRINNLDVKMVYPEPWCMPRLFTSDIAAFYEGYYKNKGVQIIKGTVATGFTADSNGEVK
EVHLKDGTXLEADIVVVGVXGRPLTTLFKGQVEEEKGGIKTDAFFKTSVPNVYAVGDVAT
FPLKLYNEIRRVEHVDHARKSAEQAVKAIKASEEGKTVEEYDYLPFFYSRSFDLSWQFYG
DNVGETVLFGDSNPATPKAKFGSYWIKDGKVVGAFLEGGTPEENKAIAKVAKAQPPVASL
DQLATEGLSFASKI
Download sequence
Identical sequences MDP0000261821 MDP0000261821|PACid:22664612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]