SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000266638 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000266638
Domain Number 1 Region: 53-225,288-398
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.41e-44
Family Thi4-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000266638
Sequence length 759
Sequence
MVYEYVLAGVLVSLLSSVFFVIINNTFSEKKKDDVANVSATGVFLAPEIEKSTDVVIVGA
GVAGAALAYTLGKEGRRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDXANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRERAXTLPNVKLXQGTVTT
LLEEKGTVKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGLILEN
CELPHANHGHVIXGDPSPILFYPISXTEVPHQLLKAFLAAVDKGIIRTMQNKSMPAAPQP
TPGAILLGDAFNMRHPLTGGGMTVALSDIVLLRDLLRPLSDFNDAPALCDYLESFYTLRK
PVSSTINTLAGALYKVFCASPDPARQEMREACFDYLSLGGICSNGPISLLSGLXPRQINL
FLHFFAVAVYGVGRLMIPFPTPKRMWLGARLILSASGIIFPIIKAEGVRQMFFPATMPAY
YRVPPHSSFYNREQDYTRTLYLTLLFVYSLQTSDYSFSTFAMLASAIYQSSSFLPNSQIP
ILCPHLSRSSLPIPTRCLYLPTSTVEDGVEDDDTRLQIKDAPRHLRDNKDQRWTIANLVE
DGGLQIDEDGALGPFPFDWSLKPXFLVARPAGRAFFPSSATTKIMDLVGLIVRASSATII
DLSPSTHLQRYEIGIPTARFWDVCVFSALLTSLENQXQAYHELHQIHTLVVQFINDYEQR
STLEFGYQFFINQMSKGYDLRLDVNKKTHKQSETLFSFS
Download sequence
Identical sequences MDP0000266638|PACid:22658651 MDP0000266638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]