SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000268357 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268357
Domain Number 1 Region: 25-56
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000527
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000268357
Sequence length 119
Sequence
GIEDAVRIRQTVIDCFERTSLPSVSEEEKKKLLSFVCVGGGPVGVEFAAELHDFVKEGLT
RELLHLLKGSSSETELMTLVHYLNLMGAXTLTGLADENESVREAALGAGHILVEHYATM
Download sequence
Identical sequences MDP0000268357|PACid:22630891 MDP0000268357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]