SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000268393 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268393
Domain Number 1 Region: 77-170
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.42e-18
Family Protein kinases, catalytic subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000268393
Sequence length 171
Sequence
MKENKNQQFYLXNYGRREKGCKSLVLNTNHCLVINFXTRNDELVAGHSGESWSELRETXE
KIGKWIRKWINGLXKQVFGLVYRATLANGSRLVVKKLSGDLGLVEREFKAEVEXLSTAQH
KNLVSLQGYCLPDGVRLLMYSYMENRSLDYWLHEKADGPSQLDWSIRLNIL
Download sequence
Identical sequences MDP0000268393|PACid:22631049 MDP0000268393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]