SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000269370 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000269370
Domain Number 1 Region: 182-348
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.97e-34
Family GMC oxidoreductases 0.000000267
Further Details:      
 
Domain Number 2 Region: 133-179,347-402
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.47e-18
Family FAD-linked reductases, N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000269370
Sequence length 420
Sequence
MGVAGDGGRAPSXGRYGCGRVGYGGGCIANQNVEKTDWDLRDWGKWRLWWTGGPELLHKM
GLNKADVGQGCLNIHQVGLKGLLAGGQQRHGVMESVELLKDLVLLILXLKIGIRDVCQLQ
ESYTVILTGHLTGVFANAEVILSAGTLGTPQLLLXSGIGPESYLSSLNITVVRDHPFVGQ
FVYDNPRNFINIVPPNPIEASIVTVLGITDYFYQCSLSSMPLTTPAYSLFPTPLVVNSTF
THIPSKIPGPXSHGSLTLNSSSDVRXXPNVRFNYFLDPTDLAHCVSAMKNTXDLLMTDAL
KPYKAQDLPGMEGFNFLGQPLPKNQTDDASFETFCRDTVASYWHYHGGCLVGKVVDCSFR
LNGIYGLRVADATLFPAAPASHPQXFYLMLGRYVGLQILKERSTXGNSLTRHHPVPFKLK
Download sequence
Identical sequences MDP0000269370 MDP0000269370|PACid:22680893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]