SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000271423 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000271423
Domain Number 1 Region: 82-199
Classification Level Classification E-value
Superfamily Flavoproteins 4.38e-29
Family Cytochrome p450 reductase N-terminal domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  MDP0000271423
Domain Number - Region: 189-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0304
Family FAD/NAD-linked reductases, N-terminal and central domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000271423
Sequence length 296
Sequence
MESFSNSMKISPLDLMATIIKGKMDPADFSGAQVTSVILENRNFIMILTTSIVVLIGYCQ
KHPGVIQPSRPLIVEEPEPEEVGNGSKKVTIFFSTQTGTAEGFAKALAEEAKAQYENVTF
KVVDLDDYVADDEAYEEKLKNESLVFFFLVTYGDGEPTDNVVRFYKWFTEGEERGEWLKN
LNYGMFGLGNRQYEHFNKWNYNLLIIGAVVGGHGAALHAVKKVLKTAIMRRLEKGSQESR
KRRLEMDLKKAGKGDWRGISRNPVPTIVGEHGNHDCGSGQRSSTIPLKKENPRDNM
Download sequence
Identical sequences MDP0000271423|PACid:22637643 MDP0000271423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]