SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000272119 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000272119
Domain Number 1 Region: 13-398
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-26
Family GDI-like N domain 0.00094
Further Details:      
 
Domain Number 2 Region: 374-486
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000405
Family GDI-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000272119
Sequence length 549
Sequence
MRTFSSDDPIEPATFDLIIIGTGLLGSVIAAAASAAGKTVLQLDPYNSYGSHFASLHLND
FTSFIHSHATPSSTASANMTPTSIDHDYTVLDLNPQLLYSNMEIATYAPEILAKHQPERF
TIDLGGPRVFFCADKAIDLILKSGVYHQVKSIDANFILDGKGQLWNVPDSRGAIFKDKSL
SLIEKNKLMKFFKLVWQHLAASDGGDEGSQNSESSKILEEDLESPFVDFLKRMQLPHKIK
SIILYGIAMVDYDQDNLEFCKSILKTREGIERLALYQKSRLTNAPEAMIYPKYGHGDLSY
AFCRRAAVKGCVYAERVPVSVLMDKHSEQYKGVRLSTGQDLFSHHLVLDPTFKFPLPPAS
SPPDLSASLKDDKGKVARGICITTSSMKPDISNCFLVYPPGSLYPEQRTSIRAIQIAGSS
AEVCPKGMFMLYFSALCDDAEQGKRSLHAAMNALLTLPVSGNRHGSTVHSEDAEKKPTLV
WSTLYIQELIMDQHEYFISTPMPDGNLNYNDLIDATAESFHRIYPDEEFFPLTSSARSLE
DDCGLVLEN
Download sequence
Identical sequences MDP0000272119 MDP0000272119|PACid:22671033 XP_008382333.1.92800 XP_017190307.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]