SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000276878 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000276878
Domain Number 1 Region: 648-878
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.12e-59
Family Mycolic acid cyclopropane synthase 0.00061
Further Details:      
 
Domain Number 2 Region: 1-332,409-441
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-49
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000276878
Sequence length 906
Sequence
MRVAVIGAGMSGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVN
VKELIXYDARLTIPVFLKTGLQVTYPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGS
RNGLSSLFAQKTNLINPYFWQMLREITKFKHDAINYLEELENNQDIDRSETLGQFIKSRG
YSELFQKAYXVPVCGSIWSCPSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC
YVKKVREVLESKGCHIRTSSEVHRVSTSDEGCTVISGDGLEEVFNGCIIAVHXPDAVRIL
GDQATSDELRVLGAFQYVYSDIFLHRDKXLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVL
QNIDETGLPFLVTLNPEHTPKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAY
XGYGFHEDGLKAGMDAAHGLLGKGXALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCL
IFLEEGGTIFTFEGTRKGCSLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDK
GLLNLIMILIANRDANSSDSKLTKKSFYLVVNEXSIQCGLTYFRCRGWWTPLLFTASIAS
AKYFFQHVSRQNTLTQARRNISRHYDLYLERSLGSRHSSRLAFCVFQSNELFSQFLDETM
TYSSAVFKTEDEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKYT
GITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLASYKYDRIISCEMLESVGHEFMDEF
FSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASS
RLCEILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQKQDISLTAXPXAFRSTKRSPQD
MEQGKK
Download sequence
Identical sequences MDP0000276878 MDP0000276878|PACid:22649644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]