SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000296599 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000296599
Domain Number 1 Region: 49-250,355-414
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.7e-38
Family FAD-linked reductases, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000296599
Sequence length 421
Sequence
MAVLTSPLLNSPPQSFPPFLRRTRTSKTTVIRXSSSSSVLSAMDPHPPKRVVVCGGGVIG
VCAAYFLSKRGAAVTLVEKSSVACAASGKAGGFLALDWCDGKPLASLARASFHLHLSLAQ
ELDGPKSYGYRPLTTLSLTVSESETSKPSGKSNLPSWVDGPARSPRTIGTAETTAQVHPY
LFTRTLISKAVEDYGVDVVIGKLETVGVENGRVNSVVLEGGRVIDSDAVVLAMGPWCGKF
ELLSSLFRVYGLKAHSIVLEPKEAEAITPHALFLSYYPSQRGKPLDPEVYPRPTGEVYVC
GMTAEEEVPDDPEQIVGKSESIEVLKRVAGTVSSHLRGGQAQVKAEQACFLPCTDDGVPV
IGEVPGVKGCYVATGHNCWGILNGPATGAAVAELVLDGKASIVDLSPFSPARFCGLKGSR
R
Download sequence
Identical sequences MDP0000296599|PACid:22628159 MDP0000296599 XP_008363063.1.92800 XP_008363064.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]