SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000301246 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000301246
Domain Number 1 Region: 157-256
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.38e-26
Family ETF-QO domain-like 0.0000312
Further Details:      
 
Domain Number 2 Region: 23-155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000205
Family FAD-linked reductases, N-terminal domain 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000301246
Sequence length 257
Sequence
MDKMGVCLTCGARFIVLRHVCYTSIPYPVFPGGALIGCSAGFLNVPKIKGTHTAMKSGML
AAEATFSLLHEGSRMEKYWDALRNSWIWEELYRARNFRPAFEYGLIPGLALSALEHYIMK
GRSPWTLKHGKPDHEATNVAQFHSPIQYPKPDGVLSFDIPTSLHRSNTNHEHDQPPHLRL
RDPNIPELVNLPEYAGPESRYCPARVYEYVPDEEGQPKLQINAQNCLHCKACDIKDPKQN
INWTPPEGGGGPGYSIM
Download sequence
Identical sequences MDP0000301246 MDP0000301246|PACid:22669391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]