SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000305861 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000305861
Domain Number 1 Region: 756-906,958-1033,1126-1227
Classification Level Classification E-value
Superfamily RNI-like 2.31e-30
Family 28-residue LRR 0.06
Further Details:      
 
Domain Number 2 Region: 60-279
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0078
Further Details:      
 
Domain Number 3 Region: 221-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0078
Further Details:      
 
Domain Number 4 Region: 342-472
Classification Level Classification E-value
Superfamily EF-hand 0.00000000884
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 5 Region: 677-727
Classification Level Classification E-value
Superfamily F-box domain 0.0000327
Family F-box domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000305861
Sequence length 1260
Sequence
MRGFAFFDRVSKAFHDYPKASKMLVVVAVSGGGYVAYAEATPEPKLISSAPVIDQVDNKK
QKIVVLGTGWAGTSFLRNLKNPNYEVQIISPRNYFAFTPLLPSVTCGTVEARSIVEPIRN
IVRKKNVDVQFTEAACLKIDAQNNKIYCHSNLENNLDGQEEFVVDYDYLIIAVGANVNTF
NTPGVMENCHFLKEVEDAQKIRRTVIDCFEKASLPTVSDEEKKRILHFAVVGGGPTGVEF
AAELHDFVNEDLVKLYPGVKDLVRITILEAGDHILNMFDKRITSFAEEKFQREGIDLKTG
SMVVKVTDKEIFTKEMKNGGEVSAMPYGMALWSTGIGTRPFIKDFMTQVGQGNRRALATD
EWLRVEGCDKVYAIGDCATINQRKVMEDIAAIFRKTDKDNSGTLTIDEYEEVIKDICERY
PQVELYLKSKQMKNMVDLLKETTDVSKGNVEFNIEDFKTALSKVDSQMKNLPATAQVAAQ
QGVYLAKCFNRMEEAEKNPEGPLRFRGEGRHRFRPFRYKHLGQFAPLGGEQTAAQLPGDW
VSIGHSSQWLWYSVYASCIINVALHCERFENNIVMAHRAVAPIQYAMGVIWTPRREAVGG
TWACLGSGGHCGSNCPFGDDAALLSGLEKYEPTYEIILDVGLPCDNELFPFIGNISGFLF
SVRVLRAAFFLFMDPKRKKSGLHDPEDEYRVRSVFPDEVLERVLGMVESGKDRGSVSLVC
KDWYDAERWSRRHVFIGNCYATSPEIVSRRFRNIRSVTLKGKPRFADFNLVPDHWGSDVR
PWVEAFAAEYPLLEELRLKRMTVTDESLEMLGVCFGGFKALSLVSCDGFSTDGLAAIATH
SKNLIELDIQENQIDEKSGSWLGCFPETFTSLEILNFASLNSDVDFDALERLVKRCISLK
VLKVNKNVTLEQLQRLLTNAPQLLELGTGSFAVQEIAACQNSQFLRAFSNCKNLHTLSGL
WEATTLYLPVVYPACTTNLTFLNLSYAAALQSWDLAELVAYCPRLRRLWVLDTVEDQGLK
AVGSNCPLLEELRVFPSDPDGDGIIRGVTESGFVAVSHGCRKLXYILYFCWQMTNAAVAT
VAQNCPDITHFRLCIMIPGQPDYMTNEPMDEAFGAVAKNCTKLQRLSVSGLLTDXAFEYI
GKYAKNLEKLSVAFAGKSDLGMQCVLKGCPKLKKLEIRDCPFGNAAFLSDIEKYESMRSL
WMSACNVTINACRLLASQMPRLNVEVMKDEGDDDCVADKVYVYRSVAGPRRDAPPFVLTF
Download sequence
Identical sequences MDP0000305861|PACid:22662391 MDP0000305861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]