SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000307336 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000307336
Domain Number 1 Region: 121-175
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-19
Family FAD-linked reductases, N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000307336
Sequence length 176
Sequence
MVSLRMGRMKAWSSGXFFDFVGLTDNLRIPENRIVNMKPMNYVSRVDYHLAFMSHSLDNH
SGLVYSIRSHVLQARAQPSSMGAQPSSMEPFAENNVVHRGGRSQRSRSAICPVQPSPGSV
KRVAVVGAGVSGLAAAYKLKSHGFDVAVFEAEGRAGGKLRSVSRDGLVWDEGANTM
Download sequence
Identical sequences MDP0000307336|PACid:22681275 MDP0000307336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]