SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000309775 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309775
Domain Number 1 Region: 218-410,605-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-37
Family HI0933 N-terminal domain-like 0.068
Further Details:      
 
Weak hits

Sequence:  MDP0000309775
Domain Number - Region: 475-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000298
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000309775
Sequence length 680
Sequence
MSFLPSTSKLCSFHPPNSIPTRVLPCPRPQTLRILGAKRAGKRRYPSEKKELKLKHKEIA
GDVKNKYEGIWRLSKLGVSIDKDPGKDFLGVSDGLLEQIAKVLEFPVPSMLPTEAFTVVR
KSFDARKRLKEPKFVYIVEMDVDKLLSLEPRAWDFISELEPKVGLVEHMPEARKSGDLIN
IIQDFKKVHQGIVSRGSGNNRSNGSEGSHTHPTAXKPKIAVVGSGPSGLFAALVLAEFGA
DVTLLERGQPVEQRGRDIGALVVRRMLQTESNFCFGEGGAGTWSDGKLVTRIGRNSGSVL
AVMETLVHFGAPEGILVDGKPHLGTDRLVPLLRNFRQHLQQLGVTIKFGTRVDDLLVDNA
QVVGVXVSDSADNSQKWGYDAVVLAVGHSARDFYQTLLSHNIDLIPKDFAVGLRIEHPQE
VVNSLQYSGLATEVRRGRGKVPVADYKVAKYVSGKDGEEPSGATSRSCYSFCMCPGGQVV
LTSTNPSEICINGMSFSKRASKWANAALVVTVSAKDFDVLNLRGPLAGVEFQREFEQRAA
RMGGGNFVVPVQTVTDFMDNKLSVTSVPPSSYRLGVKAANLHEIFPIHITETLQHSLSVF
DKETRTSSPIQIPRDNDTYESTSLKGLYPVGEGAGYAGGIVSAAVDGMYAGFAVAKNFGL
CNEGIESILGKARSAGFLEY
Download sequence
Identical sequences MDP0000309775 MDP0000309775|PACid:22670556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]