SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000314335 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000314335
Domain Number 1 Region: 161-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000148
Family Thioltransferase 0.011
Further Details:      
 
Domain Number 2 Region: 24-94
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000153
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000314335
Sequence length 231
Sequence
MSKVHLRLYMKDSEPKIQDETSKERMLRIPREDEFWSRGISACAICDGASPLFKGQVLAV
VGGGDTATEEALYLKKYARHIHLLVRRDQLRASRAMQDRQAVTAAGSGCIAALSVERYLV
GKDLIIEFHQPVTEEAKKEPSSMDVQEGFDITLTKHRGQASPTCGPCRTLKPILGTVIDE
FDHNVHFVEIEIEEDPEVVEATGIMGTPCVQFFKNKEMIRTVSGVKMKSEY
Download sequence
Identical sequences MDP0000314335|PACid:22679828 MDP0000314335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]