SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000315774 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000315774
Domain Number - Region: 1-60,92-126
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.011
Family FAD-linked reductases, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000315774
Sequence length 165
Sequence
VVEKSKAFSNHPQAHFINNRSMEVFRKLDGLAEEIQRSQPPVELWRKFLYCTFLYGSILG
QSTICNPKICGQIIFKLIGRELGDINVIDIKPWVMHAEVAEKFLSCGNRIILAGNAAHRF
PPAGGFELSIQNFRAAMAVPAVLGLDPTTANSVTNFLLELQYIAS
Download sequence
Identical sequences MDP0000315774 MDP0000315774|PACid:22650922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]