SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000317025 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000317025
Domain Number - Region: 49-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000129
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000317025
Sequence length 145
Sequence
MTALQYMNPQSGWNVSAIGAMREIPISHKDVKEIYNIINFSFSLQNIADINECEAGNHCT
GGSICKNHVGYYECYPTHRNSWLKVVFIAIFSGIGIGLGLLFLLVGAWWLYKVVRIKLKE
KFSQQDGSLLMELQRLSSGEVNLDN
Download sequence
Identical sequences MDP0000317025|PACid:22622584 MDP0000317025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]