SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000317524 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000317524
Domain Number 1 Region: 8-242
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.73e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0043
Further Details:      
 
Domain Number 2 Region: 8-48,246-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.57e-16
Family FAD-linked reductases, N-terminal domain 0.072
Further Details:      
 
Domain Number 3 Region: 273-331,371-490
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000298
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000317524
Sequence length 513
Sequence
MASETYQSKNVCVIGAGPSGLVAARELRNEGHRVVVLEQNHDVGGQWLYDPNVEGEDPLG
RAPTLKVHSSLYTSLRLMLPREIAGFTDFPFAVKKGRDMRRFPGHTELLLYLKDFCDWFG
LRELIRFNTRVSYVGMLDGDHAGGCKDLKWVVRSVEKKTEIFVEEVFDAVVVASGHYSKP
RLPSIKGMDAWKRKQMHSHIYRVPEPFRDEARQYIVNCEIVVVVVGNSVSGQDISMELVD
VAKAIYLSAKSLDISEGLSKVISKHENLHLRPQIESLQEDGNVLFVDGSWVIADTIIYCT
GYSYTFPFLDTKGIVTIDDNRVGPLYVHTFPPSLAPSLSFMGIATKLWKXXFCKSKNKDM
NDKRYSHDPRKAGSPVGVLGRPVLVCFEIIGFPFFESQAKWIAQLLSGXTTLPSRDDMMH
SIKEFYHSREIAGIPKHNTHEIGDFEYCDRYGDHIGFPRLEEWRKKICLSTIRNAETDLE
TYKDSWDDHELLQEALQSPHFTQLGPQDLDFPL
Download sequence
Identical sequences MDP0000317524|PACid:22631851 MDP0000317524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]