SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000318858 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000318858
Domain Number 1 Region: 602-1366
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.7e-255
Family FMN-linked oxidoreductases 0.00000000000407
Further Details:      
 
Domain Number 2 Region: 110-560
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.43e-145
Family Class II glutamine amidotransferases 0.00000000871
Further Details:      
 
Domain Number 3 Region: 1383-1646
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 1.83e-96
Family Alpha subunit of glutamate synthase, C-terminal domain 0.000000769
Further Details:      
 
Domain Number 4 Region: 1849-2189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.21e-62
Family FAD-linked reductases, N-terminal domain 0.079
Further Details:      
 
Domain Number 5 Region: 1705-1862
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 7.85e-37
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000318858
Sequence length 2228
Sequence
MLASTGGSVVQLRAKSSLLPSQLNATPVARLGGSRAAVTTCSASRKSSKALAKKFFGTRL
RASGSERLHLWRSDGPGRSPKLRVVVRNMLSAVPEKPLGLYDPSFDKDSCGVGFVAELSG
EVSRKTVRRRVCLCWWEMKIAKRTFMITDAIEMLERMTHRGACGCETNTGDGAGILVGVP
HDFYKEVTKDAGFDLPPAGEYAVGMFFLPASESRREESKRVFAKVAESLGHTVLGWRSVP
TDNSDLGKSALQTEPVIEQVFLTATPRSKLDLERQMYILRRLSMVAIRAALNLELGGAKD
FYICSLSSRTVVYKGQLKPIQLKDYYYADLGNERFTSYMALVHSRFSTNTFPSWDRAQPM
RIIGHNGEINTLRGNVNWMKAREGLLKCKELGLSENDLKKLLPIVDASSSDSGAFDGVLE
LLVQAGRSLPEAIMMLIPEAWQNDKNMDPDRKALYEYFSSLMEPWDGPALISFTDGRYLG
ATLDRNGLRPGRFYVTHSGRVIMASEVGVVDIPPEDVSRKGRLNPGMMLLVDFENHVVVD
DEALKQQYSLARPYGEWLQRQKIELKDIVDSVHESDRVPPSIAGAIPASTDDETMENMGI
HGLLAPLKAFGYTVESLEMLLLPMAKDGVEALGSMGNDTPLAVMSNREKLTFEYFKQMFA
QVTNPPIDPIREKVVTSMECMIGPEGDLTETTEEQCHRLSLKGPLLTIDEMEAIKQMNYR
GWRCKVLDITYSKKRGREGLEETLDRICAEAREAIKKGYTTLVLSDRAFSPKRVAVSSLL
AVGAVHQHLVKNLERTQVGLIIESAEPREVHHFCTLVGFGADAICPYLAIEAIWRLQVDG
KIPPKANGAIYSKDELVKKYFKASNYGMMKVLAKMGISTLASYKGAQIFEALGLSSEVVE
RCFAGTPSRVEGATFEMLARDELHMHELAFPSRSYPPGSAEAVALPNPGDYHWRKGGEVH
LNDPFAIAKLQEAARTNSVAAYKEYSKFIHELNKACNLRGLLKFKNTEQQIHLDEVEPAS
EIVKRFCTGAMSYGSISLEAHSTLAIAMNRIGGKSNTGEGGEQPSRMEPLSDGSRNPKRS
AIKQVASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAVTRNSTAGVGL
ISPPPHHDIYSIEDLAQLIHDLKNANPAARISVKLVSEAGVGVVASGVVKGHADHVLISG
HDGGTGASRWTGIKNAGLPWELGLAETHQTLVXNDLRGRTTLQTDGQLKTGRDVAIAALL
GAEEFGFSTAPLITLGCIMMRKCHKNTCPVGIATQDPVLREKFAGEPEHVINFFFMIAEE
LREIMAQLGFRTINEMVGRSDMLEVDREVTKNNEKLDNIDLSLLLRPAADLRPGAAQYCV
EKQDHGLDMALDHKLIAMSKAALEKALPVYFETPICNVNRAVGTMLSHEVTKRYNRAGLP
ADTIHIKFSGSAGQSLGAFLCPGIMLELEGDSNDYVGKGLSGGKIVVYPPKGSKFDPKEN
IVIGNVALYGATSGEAYFNGMAAERFCVRNSGAKAVVEGVGDHGCEYMTGGTVVVLGKTG
RNFAAGMSGGIAYVYDVDGQFRSRCNPELVDLDRLEEEDILTLQMMIQQHQRHTNSLLAI
EVLADFENLLPKFIKVIPREYKRVLADMKEETKQVIEHEEEDEPELEEKDAFEELKKLAA
ASLNGKSNQVEDAEALKRPSQVTDAVKHRGFISYEREGVQYRDPNVRMNDWKEVMEETKP
GPLVKTQSARCMDCGTPFCHQENTGCPLGNKIPEFNELVYQNRWHEALERLLETNNFPEF
TGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKAFEEGWMVPRPPVKRTGKRVAIVGSG
PAGLAAADQLNRIGHTVTVYERADRIGGLMMYGVPNMKTDKVEIVQRRVNLMTEEGVNFV
VNANIGNDPLYSLERLREENNAIVLAVGATKPRDLPVPGRELSGVHFAMEFLRANTKSLL
DSNLEDGNYISAKGKKVVVIGGGDTGTDCIGTSVRHGCTSIINLELLPEPPRTRAPGNPW
PQWPRVFRVDYGHQEVAAKFGKDPRTYEVLTKRFVGDENGAVKGLEVVRVKWEKDETGRF
QFKEIEGSEEILEADLVLLAMGFLGPEATVAEKLGLERDQRSNYKADYGRFSTNVDGVFA
AGDCRRGQSLVVWAISEGRQAAAQVDKYLSNEEEDRTISNGSHPDLSKRHQDLSKRNPTG
SSKHTVMT
Download sequence
Identical sequences MDP0000318858 MDP0000318858|PACid:22682838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]