SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000319421 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000319421
Domain Number 1 Region: 10-169,272-376
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.97e-52
Family FAD-linked reductases, N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000319421
Sequence length 399
Sequence
MEIGDTRESIVIVGGGICGLATALALHRKGIRSVVLERSNRLPATGVAIIVHLNGWRALD
QLGVASLLRQTSFPILSGQLISLGSGEIEXMDVGKEELRVLKRTDLVSVLADNLPPNTVR
FGCEVHSVKLNPGTSSPVLQLQDGTILNPKVVIGCDGVNSIVSNVMGXKASNIFRICVIR
GFTRYPDGHEFGSEFTLTRKDDTQVGRLPMTESLVYWFMTRKHSSQDSAASKDQKLIREL
GVKSVEGFPTSIIEMFKNCELDSIHLTEYVRYHAPWDIXRXPSRAGTVSLAGDAMHTMGP
FLAQGGSAALEDAVVLARCLAQKTRVDLRGRGTKLMVEEALDQYVKERKTRVLXLSLQTY
LIGKMFHTSSQFVKLICIVLLAVLFSESHGHTRYDCGSL
Download sequence
Identical sequences MDP0000319421 MDP0000319421|PACid:22624123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]