SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000320992 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000320992
Domain Number - Region: 47-121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0956
Family Nucleotide and nucleoside kinases 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000320992
Sequence length 208
Sequence
MMSGGKKVMYGKGEEGWDGEEEERKGYEGSCHRLPAIAKGQRRWRSKEQFLLFKNIASAV
NERKLVPDEVIFAXLSKRSEEGYFRGENRLILVGIPRTRTQAEIVDQIADMDLVVNLECT
NRRKSSKMGSNPFLLVSDQAAGRLTEQTHRFSGQNLARRNLAWTVGCFTSSAYKCCQIFP
EAHCXIALHLRLFFFVCXPGVQVYVYKM
Download sequence
Identical sequences MDP0000320992|PACid:22658321 MDP0000320992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]