SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321186 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321186
Domain Number 1 Region: 84-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-44
Family C-terminal domain of adrenodoxin reductase-like 0.000018
Further Details:      
 
Domain Number 2 Region: 23-140,322-358
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000233
Family C-terminal domain of adrenodoxin reductase-like 0.0022
Further Details:      
 
Weak hits

Sequence:  MDP0000321186
Domain Number - Region: 312-420
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0147
Family N-terminal domain of adrenodoxin reductase-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321186
Sequence length 473
Sequence
MANFQARTWLYRTFSTVASQPLRVCVVGSGPAGFYTAEKMXKAHQEAEVDIIDRLPXPFG
LVRSGVAPDHPETKVVLAYGAESDRVLGIPGEDLSGVYAAREFVWWYNGHPNSRYLNPDL
KSSDTVIILGQGNVALDAARILLRPTTELATTDIASHALAALEDSSIRKVYLVGRWGPVQ
AACTAKELREILGIKDLHVHKKETDLLPTAADEEEMKNNRIRKRVYELLSKAAMTRPSHX
SSDARELHFVFFRKPNKFLESDERRDHVSGVXLEKTKLIGISPGEQTAAGTGQFEELGCG
XVLKSIGYKSVPVDGLPFDHRKGVVPNVRGRVLSDTSGDPTLLEKGLYVCGWLKRGPTGI
IATNLYCAEETVASISEDIKLGRLTSSSNSGREGLLQLLDDRNVRVISFRDWEKIRLGRK
TAREFKKQAEGKTSHVGGASESYDPXEFLTCKHCSQSYRSILVESVFVDHTSS
Download sequence
Identical sequences MDP0000321186 MDP0000321186|PACid:22667177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]