SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321788 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321788
Domain Number 1 Region: 26-216
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.49e-21
Family GDI-like N domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321788
Sequence length 218
Sequence
MSLCTGRQMQGNLNLITQALAAVGCEMPVIPDPTTVHYHLPDNLSVLVHREYSEFISERT
SKFPHEKQGILKFYGVCWKVFNASNSLELKSLEEPIYHFGQFFQKPVECLTLAYYLPQNA
GDIACKYIQDPQLLSFIDAEVMCDRHYGGINYPIGGVGGIXKSLAKGLVDQGSQILYKAN
VTNIIVDPGRVVGVRLSDGREFFAKTIISNATRWNTFG
Download sequence
Identical sequences MDP0000321788|PACid:22641842 MDP0000321788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]