SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000322449 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000322449
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000055
Family GDI-like N domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000322449
Sequence length 158
Sequence
GNLNLITQALAAVGCEMPVIPDPTTVHYHLPDNLSVLVHREYSEFISERTSKFPHEKQGI
LKFYGVCWKVFNASNSLELKSLEEPIYHFGQFFQKPVECLTLAYYLPQNAGDIACKYIQD
PQLLSFIDAEVMCDRHYGGINYPIGGVGGIAKSLAKGL
Download sequence
Identical sequences MDP0000322449 MDP0000322449|PACid:22657441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]