SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000370307 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000370307
Domain Number 1 Region: 39-104
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000197
Family RecA protein-like (ATPase-domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000370307
Sequence length 116
Sequence
MVXFAACTHDKNNKSTSDKEFAIDHMDMPKXSEETIRLATRILRAGKIRLFGEAGVGKTV
LIMELINIAKAHGGVSVFGGVGERTHEGNGLYMEMKESGVINEQNIAKSKVAIIYS
Download sequence
Identical sequences MDP0000370307|PACid:22634406 MDP0000370307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]