SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000374867 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000374867
Domain Number - Region: 155-187
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00777
Family GDI-like N domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000374867
Sequence length 211
Sequence
MAFPSSSQVDPKMLDPSLNQSDLLGLPGLPGLPGLPGLPGLPGLPGLPGLPGLPGLPGLP
GLPGLPLAAEKTSSESSNSKTSKNGQLGDNKEVAHPDSLPADXLVSPTSSKFAISXSILS
SCDLPCKGRNLNGVFNPSPKAXNKLFNDDGPIKXTNFDLIVIGTGLPGSXXAAXXSXAXX
TVLXLDEWWDSHPLLLIPRWEQPAATVVDWV
Download sequence
Identical sequences MDP0000374867 MDP0000374867|PACid:22644271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]