SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000399642 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000399642
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 2 Region: 357-515
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000881
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000399642
Sequence length 518
Sequence
MGKQVAIVGAGISGLLACKYTLSKGFQPIVFESTSSIGGVWTKTIESTKLQTPKPLYQFS
DFPWPSSVEEDFPSQHQVLDYIQSYAQHFDLLKHIKFDTKVCGIEYEGASEDEMQAWSHW
GGTGEPFSSXGKWKVAVEDKHSRSTEVYLVDFVILCIGRFSDVPNIPEFPFNKGPEAFHG
EVIHSKDYAAMDYERARNFVKGKRVTVVGFQKSALDIAMECSNXNGIEHPCTVIYKTEHW
TLPDYLPWGVPLTYLYXNRFXELLIHKPGEGILLGLLATILSPLRWGFSKFVESYVTKKL
GLAKYGMVPXHXFLQEISSCLISTXPEKFYDRVQEGSIILKKSPXSFSFCQEGVLVEGEV
SPVKTDXXILATGFRGDKKLKDIFVSPTFQDYIAGSPEAILPLYRECIHGRIPQLAVIGF
SESLSNLYTSEMRCRWVAELLGRTFTLPSIKEMEKDVNEWDGFAKRYAGKYYRRSCNGTV
HIWYNDQLCKDMEWNPKRKKGLFAELFEPYGPLDYAPS
Download sequence
Identical sequences MDP0000399642|PACid:22674547 MDP0000399642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]