SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000407932 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000407932
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000596
Family GidA-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000407932
Sequence length 163
Sequence
MVTDILLGKNDNVEGVRTFFGMNFYSPSVILTTGTFMSGKIWVGRTSMPAGRAGESASLG
LTENLQRLGFETDRLKTGTPARVDCRTVDFSGLEPQRGDEEVGWFSFDLDVHIEREQMCC
YLTRTTKSTHQLIKDNLHETPTYGGWVEAKGPRYCPSIEDKVS
Download sequence
Identical sequences MDP0000407932 MDP0000407932|PACid:22626437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]