SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000437365 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000437365
Domain Number 1 Region: 15-51
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000936
Family FAD-linked reductases, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000437365
Sequence length 102
Sequence
MXKLQGSSFGDGEAEEYDVVVVGSGYGGSVVACRLSMAGGRSVCLLEKGRRWEAKDFPTD
SFKLLSASRVESRNLGLSLGSKDALIQVCMSLIFKCTCKQKK
Download sequence
Identical sequences MDP0000437365|PACid:22632357 MDP0000437365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]