SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000490521 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000490521
Domain Number 1 Region: 48-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-16
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000490521
Sequence length 168
Sequence
MKLEEEDHHPSNVRLFGVGLGSSLNDPRGGHEPSTDLYLWDPTWDYSSIWKIRKRLAASD
LGELSRLLMPKEAVRKHVMSYLDDKSAKMVDSKEGLPVTIVDWDTCNRRELTFKHWNSGD
FYVLNGGWRPEFVVRRGLKENDEIGLYLDWDWKTSKYIFRFSVLQRAK
Download sequence
Identical sequences MDP0000490521 MDP0000490521|PACid:22639541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]