SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000511757 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000511757
Domain Number - Region: 97-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family Laminin-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000511757
Sequence length 153
Sequence
MKSGGSLNQEQVADSCEEHGVLGESVVWEEXCQLLYPDVKFXGEFHVADXIALANKKTIS
DPKKFEYVVKENLGELVKLAAYNVSAKMYATGDVQFEDRVIYALVQCTRNLSGDDCDKCL
RHHRRRFERVLFLHCCTASAPELLTEIRVVCLV
Download sequence
Identical sequences MDP0000511757 MDP0000511757|PACid:22677917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]