SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000521331 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000521331
Domain Number 1 Region: 476-701
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-52
Family Protein kinases, catalytic subunit 0.00039
Further Details:      
 
Domain Number 2 Region: 82-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-22
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  MDP0000521331
Domain Number - Region: 363-434
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Hairpin loop containing domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000521331
Sequence length 748
Sequence
MRKLTMNSTEYFFVSTVLLLFLVILPSSISVTLDAITPNQPLREDDVLLSTTKFFALGFF
KPGNSRNRYIGVWYNKIPIQTIVWIANRENPIVPTAGTGLLAIHADHGGLVLYGEDQNTP
XWSTNLTVSSPNNSVIAKLLDTGNLVVVEINGGSSEKVLWQGFDYPTNTMLPVMKLGLDR
RSGFNWFLTSWKSQDDPGMGNCSXRIEPSESPQGFLYMGQTPLWRTGPWIGERWSGVPQM
QNKIFFNVTFKNNQDEVSIMYSVVYESIFVKMVIDESGNIERSAWQDNKWVQYWSAPDGQ
CDFYGKCGPNSICDPYPKFADKFECKCLPGFEPKLXHEWYLRDWSGGCVRQKGSSVCQNG
EGFVKLERVKVPDTSTARVNMSRSXEACKEECLRNCSCTAYANADERQGGSGCITWHGDL
MDTRTYLDTGQDLYVRVHANVSGQRSQDKFFNVTVASTAWEDSSARTNIDESGINSELPF
FELSTIVKATNNFASNNKLGTGGFGSVYKGVLDNGXXIAVKRLAKNSGQGIGEFKNEVVL
LSKLQHRNLVRIMGCCVQDEEKMXIYEYLPNKTKXAFLDWTRCFEIICGIARGILYLHQD
SRLXIIHRDLKAXNVLLDSAMNPKISDFGMARIFGAEQIEANTNRVVWDLWKENXALEII
DSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPGFLLKRG
YHTSGDPSTNTDGACSVNDMTYTEAEGR
Download sequence
Identical sequences MDP0000521331 MDP0000521331|PACid:22672665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]