SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000538071 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000538071
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.05e-29
Family GMC oxidoreductases 0.00063
Further Details:      
 
Domain Number 2 Region: 121-176
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000142
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000538071
Sequence length 183
Sequence
MDSLEDAAFXGGFILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIET
IEKIXESKAFSKFRYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDTVMTIWHYH
GGCQVGRVVDHDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLASD
VSN
Download sequence
Identical sequences MDP0000538071 MDP0000538071|PACid:22663035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]