SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000543592 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000543592
Domain Number 1 Region: 67-176
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.34e-22
Family PHBH-like 0.022
Further Details:      
 
Weak hits

Sequence:  MDP0000543592
Domain Number - Region: 29-63
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00984
Family FAD-linked reductases, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000543592
Sequence length 180
Sequence
MEFVNRLEDWTKLIKISDPMEEGCRLGPVVSKGQTNEIIEIVGDLLVAADGCLSSIRQSF
VPDHKLRYSGYCAWRGXLDFTGNESXETLTGIRREYPXLGKCLYFXLGSGTHTVLYELLN
RRLNWIWYVHQPEPDLKHNSMTMKATSXMIQSMHKEAEKMWLPEFVRVIKETKEPFSWLE
Download sequence
Identical sequences MDP0000543592|PACid:22649791 MDP0000543592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]