SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000561228 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000561228
Domain Number 1 Region: 24-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-45
Family FAD-linked reductases, N-terminal domain 0.0000000024
Further Details:      
 
Domain Number 2 Region: 312-480
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-30
Family GMC oxidoreductases 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000561228
Sequence length 603
Sequence
MLSLLQPISFLFTKENSLTSHFADFSYSKSVINATDLPLEEVYDYIVVGGGTAGCPLAAT
LSSKYSVLVLERGSFPTSYPNVLTQEGFIYNLQQEDDGETPVQRVMSEDGIPTVRGRILG
GTSMISAGVYARANISFFNESGVEWDINLVNATYEWIEDTIVYKPNAFAWQTVTQKAFLE
AGVLPENGFSLDHVPETRITGSTFDNSGTRHAADELLNRGDLDNLRVAVHANVEKIVFSS
SESRLSATGVIYKDSNGISHRAYVRDQGEVILSAGTMGTPQLLLLSGVGPESYLSSLGIP
VVLDHPYVGQFLYDNPRNFINILPPNPIEPSIVTVLGIRDDFWQCSISCGPLTAPPYSLF
PSQSYPLPINSTFAHIPNKVPGPHSHGSLTLNSSSDVTIGPNVRFNYFSNAADLAHCVSG
MKQIGYLLRTNAFKPYKTQDLPGIEGFTFLGLPLPNNQTDDALETFCRDSLASYWHYHGG
CIVGKVVDGGLHVNGIDALRIVDSSTFPVTPASHPMGFYLMLGRYMGLQILQERSAWVGM
SCMDGAMQSLQRGICPHPMNFEENLEGNPNRAPPLRESLSSGVKVWETAHNGISIFPSSI
VFR
Download sequence
Identical sequences MDP0000561228|PACid:22637769 MDP0000561228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]