SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000569169 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000569169
Domain Number 1 Region: 66-186,221-254
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.04e-22
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000569169
Sequence length 286
Sequence
MATATRLRRLGAAACVATAASGAFLLQPSFSANDRGNGPSSLGAVRQRISDPNAVVPSRA
AQEAALISASASNPLDILVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGLRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDARLNVG
LACTAAVAGAAFHYWYVLFVYLPXMXKGXVYFXCDXVXXILFPVIX
Download sequence
Identical sequences MDP0000569169 MDP0000569169|PACid:22666591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]