SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000582079 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000582079
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.3e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 
Domain Number 2 Region: 171-206,261-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000129
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000582079
Sequence length 380
Sequence
MEEVQVIIVGAGPAGLATSACLNHLKISNVVLEREDCYASLWKKRSYDRLKLHLAKEFCE
LPYMTFPPNAPTYIPKDMFVQYLETNVSQLGINPRCNQNVKSALYEVDINKWRVTAENTL
LGAQEEYLGKFLVVASGENSIGYVPEVQGLDEFKGEAIHSSNYENGKKYGGKNVLVVGSG
NSGMEIAYDLSNSGANTSIVIRSPVHVLNKEIVHFGMVSLKFLPLNIVDKAVVLLGKLKY
GDLTKYGIRKPKEGPFFLKAAKGRAPTIDVGSINKIKTGEIKVLPSITSIDGDLIRFQNG
NVDSYNAIIFATGYKSSVLNWLQDDNHYFNENGMPQKSFPNHWKSEKKGLYSAGFSRRGL
FGIAYDARSIAEDISSCLTS
Download sequence
Identical sequences MDP0000582079|PACid:22634000 MDP0000582079 XP_008378656.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]