SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000596090 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000596090
Domain Number 1 Region: 87-136
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000493
Family Retroviral integrase, catalytic domain 0.044
Further Details:      
 
Weak hits

Sequence:  MDP0000596090
Domain Number - Region: 142-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00141
Family N-terminal domain of adrenodoxin reductase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000596090
Sequence length 229
Sequence
MQGPKCTSITYPYFGWLDDLMRHLEHDPWILQKSKEVMEGPTSGVIDKSLSKYHLDNGFL
KYNSRMVIPPDLSWRKRLFEKHHFTPITGHEGDATTIVSDRDYVFLSMFWNEFFKLQGSR
LCMSSEYHPQRDGQSEVGLVVDLTVVDGGPVGLIVAQQVSEAGFSIYSIDPSPKLIWPNS
YGVWVDEFETMDLLDCLDTTWSGAVVYIGEELNKDLNRPYGRVNRKQLK
Download sequence
Identical sequences MDP0000596090 MDP0000742489 MDP0000596090|PACid:22632224 MDP0000742489|PACid:22661380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]